Lineage for d1japa_ (1jap A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55533] (10 PDB entries) 
Domain d1japa_: 1jap A: [40349]
Details for d1japa_
PDB Entry: 1jap (more details), 1.82 Å
PDB Description: complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (met80 form)
SCOP Domain Sequences for d1japa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1japa_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg
SCOP Domain Coordinates for d1japa_:
Click to download the PDB-style file with coordinates for d1japa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1japa_:
- d1japa_ appears in SCOP 1.57
- d1japa_ appears in the current release, SCOPe 2.08
View in 3D