SCOPe 2.08: Domain d1ayka_: 1ayk A:

Lineage for d1ayka_ (1ayk A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
   Uniprot P03956 32-466

8. Domain d1ayka_: 1ayk A: [40345]
   complexed with ca, zn

Details for d1ayka_

PDB Entry: 1ayk

PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures

PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d1ayka_:

Sequence; same for both SEQRES and ATOM records:

>d1ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp

Timeline for d1ayka_:

• d1ayka_ first appeared (with stable ids) in SCOP 1.55, called d1ayk__
  
• d1ayka_ appears in SCOPe 2.07