PDB entry 1ayk

View 1ayk on RCSB PDB site
Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures
Class: metalloprotease
Keywords: matrix metalloprotease, hydrolase, metalloprotease, glycoprotein
Deposited on 1997-11-06, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: collagenase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03956 (0-168)
  Domains in SCOPe 2.08: d1ayka_
• Heterogens: ZN, CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aykA (A:)
  vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
  isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
  ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp