Lineage for d1ayk__ (1ayk -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34427Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins)
  6. 34437Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 34438Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)
  8. 34449Domain d1ayk__: 1ayk - [40345]

Details for d1ayk__

PDB Entry: 1ayk (more details)

PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures

SCOP Domain Sequences for d1ayk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayk__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp

SCOP Domain Coordinates for d1ayk__:

Click to download the PDB-style file with coordinates for d1ayk__.
(The format of our PDB-style files is described here.)

Timeline for d1ayk__: