Lineage for d1ayk__ (1ayk -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) Protein Fibroblast collagenase (MMP-1) [55529] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) 
Domain d1ayk__: 1ayk - [40345]
Details for d1ayk__
PDB Entry: 1ayk (more details)
PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures
SCOP Domain Sequences for d1ayk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayk__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
SCOP Domain Coordinates for d1ayk__:
Click to download the PDB-style file with coordinates for d1ayk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayk__:
- d1ayk__ appears in SCOP 1.57
- d1ayk__ appears in the current release, SCOPe 2.08, called d1ayka_
