Lineage for d3ayka_ (3ayk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2570956Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 2570957Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
    Uniprot P03956 32-466
  8. 2570977Domain d3ayka_: 3ayk A: [40343]
    complexed with ca, cgs, zn

Details for d3ayka_

PDB Entry: 3ayk (more details)

PDB Description: catalytic fragment of human fibroblast collagenase complexed with cgs- 27023a, nmr, minimized average structure
PDB Compounds: (A:) protein (collagenase)

SCOPe Domain Sequences for d3ayka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOPe Domain Coordinates for d3ayka_:

Click to download the PDB-style file with coordinates for d3ayka_.
(The format of our PDB-style files is described here.)

Timeline for d3ayka_: