Lineage for d3ayka_ (3ayk A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) Protein Fibroblast collagenase (MMP-1) [55529] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) 
Domain d3ayka_: 3ayk A: [40343]
Details for d3ayka_
PDB Entry: 3ayk (more details)
PDB Description: catalytic fragment of human fibroblast collagenase complexed with cgs- 27023a, nmr, minimized average structure
SCOP Domain Sequences for d3ayka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs
SCOP Domain Coordinates for d3ayka_:
Click to download the PDB-style file with coordinates for d3ayka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ayka_:
- d3ayka_ appears in SCOP 1.57
- d3ayka_ appears in the current release, SCOPe 2.08
View in 3D