SCOPe 2.08: Domain d6wvwb_: 6wvw B:

Lineage for d6wvwb_ (6wvw B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein automated matches [254664] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries)

8. Domain d6wvwb_: 6wvw B: [402753]
   Other proteins in same PDB: d6wvwc_, d6wvwd_, d6wvwe2, d6wvwg_, d6wvwh_
   automated match to d1sfcf_
   complexed with ca, mpd

Details for d6wvwb_

PDB Entry: 6wvw, 2.11 Å

PDB Description: crystal structure of the r59p-snap25 containing snare complex

PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d6wvwb_:

Sequence; same for both SEQRES and ATOM records:

>d6wvwb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
tkkavk

Timeline for d6wvwb_:

• d6wvwb_ first appeared in SCOPe 2.07