Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein Dihydrolipoamide dehydrogenase [55436] (8 species) |
Species Pea (Pisum sativum) [TaxId:3888] [55442] (1 PDB entry) |
Domain d1dxld3: 1dxl D:348-470 [40217] Other proteins in same PDB: d1dxla1, d1dxla2, d1dxlb1, d1dxlb2, d1dxlc1, d1dxlc2, d1dxld1, d1dxld2 complexed with fad |
PDB Entry: 1dxl (more details), 3.15 Å
SCOPe Domain Sequences for d1dxld3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxld3 d.87.1.1 (D:348-470) Dihydrolipoamide dehydrogenase {Pea (Pisum sativum) [TaxId: 3888]} ydkvpgvvytnpevasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaek etdkilgvhimapnageliheaaialqydassediarvchahptmseaikeaamatydkp ihi
Timeline for d1dxld3: