Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Dihydrolipoamide dehydrogenase [51959] (8 species) |
Species Pea (Pisum sativum) [TaxId:3888] [51965] (1 PDB entry) |
Domain d1dxld1: 1dxl D:4-152,D:276-347 [30591] Other proteins in same PDB: d1dxla3, d1dxlb3, d1dxlc3, d1dxld3 complexed with fad |
PDB Entry: 1dxl (more details), 3.15 Å
SCOPe Domain Sequences for d1dxld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxld1 c.3.1.5 (D:4-152,D:276-347) Dihydrolipoamide dehydrogenase {Pea (Pisum sativum) [TaxId: 3888]} sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp seisvdtiegentvvkgkhiiiatgsdvkXgrtpftsglnldkigvetdklgrilvnerf stnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvd
Timeline for d1dxld1: