Lineage for d1dxld3 (1dxl D:348-470)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [55442] (1 PDB entry)
  8. Domain d1dxld3: 1dxl D:348-470 [40217]
    Other proteins in same PDB: d1dxla1, d1dxla2, d1dxlb1, d1dxlb2, d1dxlc1, d1dxlc2, d1dxld1, d1dxld2
    complexed with fad

Details for d1dxld3

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum
PDB Compounds: (D:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1dxld3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxld3 d.87.1.1 (D:348-470) Dihydrolipoamide dehydrogenase {Pea (Pisum sativum) [TaxId: 3888]}
ydkvpgvvytnpevasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaek
etdkilgvhimapnageliheaaialqydassediarvchahptmseaikeaamatydkp
ihi

SCOPe Domain Coordinates for d1dxld3 are not available.

Timeline for d1dxld3:

Domains from same chain:
(mouse over for more information)
d1dxld1, d1dxld2
Domains from other chains:
(mouse over for more information)
d1dxla1, d1dxla2, d1dxla3, d1dxlb1, d1dxlb2, d1dxlb3, d1dxlc1, d1dxlc2, d1dxlc3