Lineage for d7cb5b2 (7cb5 B:176-467)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2335056Species Staphylococcus aureus [TaxId:426430] [401774] (4 PDB entries)
  8. 2335066Domain d7cb5b2: 7cb5 B:176-467 [401884]
    Other proteins in same PDB: d7cb5a1, d7cb5b1, d7cb5c1, d7cb5d1
    automated match to d2w90a2
    complexed with 6pg

Details for d7cb5b2

PDB Entry: 7cb5 (more details), 2.54 Å

PDB Description: the 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound)
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d7cb5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cb5b2 a.100.1.0 (B:176-467) automated matches {Staphylococcus aureus [TaxId: 426430]}
gaghyvkmvhngieyadmqliaesyammkellgmshediaqtfkdwnagelesylieitg
difmkldenkealvekildtagqkgtgkwtsinalelgipltiitesvfarfissikeer
vnaskelngpkasfdgdkkdflekirkalymskicsyaqgfaqmrkasednewnlklgdl
amiwregciiraqflqkikdaydnnpglqnllldpyfknivteyqdalrdvvatgvqngv
ptpgfsssinyydsyraadlpanliqaqrdyfgahtyerkdkegvfhtqwie

SCOPe Domain Coordinates for d7cb5b2:

Click to download the PDB-style file with coordinates for d7cb5b2.
(The format of our PDB-style files is described here.)

Timeline for d7cb5b2: