Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Staphylococcus aureus [TaxId:426430] [401772] (4 PDB entries) |
Domain d7cb5c1: 7cb5 C:1-175 [401839] Other proteins in same PDB: d7cb5a2, d7cb5b2, d7cb5c2, d7cb5d2 automated match to d2w8za1 complexed with 6pg |
PDB Entry: 7cb5 (more details), 2.54 Å
SCOPe Domain Sequences for d7cb5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cb5c1 c.2.1.0 (C:1-175) automated matches {Staphylococcus aureus [TaxId: 426430]} mtqqigviglavmgknlawniesrgysvsvfnrssektdlmveeskgknihptysleefv nslekprkillmvqagkatdatidsllpllddgdilidggntnyqdtirrnkalaqsain figmgvsggeigaltgpslmpggqeeaynkvadildaiaakakdgascvtyigpn
Timeline for d7cb5c1: