Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Staphylococcus aureus [TaxId:426430] [401774] (4 PDB entries) |
Domain d7cb5a2: 7cb5 A:176-466 [401781] Other proteins in same PDB: d7cb5a1, d7cb5b1, d7cb5c1, d7cb5d1 automated match to d2w90a2 complexed with 6pg |
PDB Entry: 7cb5 (more details), 2.54 Å
SCOPe Domain Sequences for d7cb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cb5a2 a.100.1.0 (A:176-466) automated matches {Staphylococcus aureus [TaxId: 426430]} gaghyvkmvhngieyadmqliaesyammkellgmshediaqtfkdwnagelesylieitg difmkldenkealvekildtagqkgtgkwtsinalelgipltiitesvfarfissikeer vnaskelngpkasfdgdkkdflekirkalymskicsyaqgfaqmrkasednewnlklgdl amiwregciiraqflqkikdaydnnpglqnllldpyfknivteyqdalrdvvatgvqngv ptpgfsssinyydsyraadlpanliqaqrdyfgahtyerkdkegvfhtqwi
Timeline for d7cb5a2: