![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) |
![]() | Protein Trypanothione reductase [55429] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
![]() | Domain d1typa3: 1typ A:359-487 [40186] Other proteins in same PDB: d1typa1, d1typa2, d1typb1, d1typb2 |
PDB Entry: 1typ (more details), 2.8 Å
SCOP Domain Sequences for d1typa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1typa3 d.87.1.1 (A:359-487) Trypanothione reductase {Crithidia fasciculata} htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy qkgkrveki
Timeline for d1typa3: