Lineage for d4grt_3 (4grt 364-478)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) 
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) Protein Glutathione reductase [55426] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55427] (16 PDB entries) 
Domain d4grt_3: 4grt 364-478 [40167]
Other proteins in same PDB: d4grt_1, d4grt_2
Details for d4grt_3
PDB Entry: 4grt (more details), 2.8 Å
PDB Description: human glutathione reductase a34e, r37w mutant, mixed disulfide between trypanothione and the enzyme
SCOP Domain Sequences for d4grt_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4grt_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
SCOP Domain Coordinates for d4grt_3:
Click to download the PDB-style file with coordinates for d4grt_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4grt_3:
- d4grt_3 appears in SCOP 1.57
- d4grt_3 appears in the current release, SCOPe 2.08, called d4grta3
View in 3D
