SCOP 1.69: Domain d1gav7_: 1gav 7:

Lineage for d1gav7_ (1gav 7:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein GA coat protein [55409] (1 species)

7. Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)

8. Domain d1gav7_: 1gav 7: [40128]

Details for d1gav7_

PDB Entry: 1gav, 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gav7_:

Sequence; same for both SEQRES and ATOM records:

>d1gav7_ d.85.1.1 (7:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

Timeline for d1gav7_:

• d1gav7_ first appeared (with stable ids) in SCOP 1.55
  
• d1gav7_ appears in SCOP 1.67
  
• d1gav7_ appears in SCOP 1.71
  
• d1gav7_ appears in the current release, SCOPe 2.08