SCOP 1.69: Domain d1gavh_: 1gav H:

Lineage for d1gavh_ (1gav H:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein GA coat protein [55409] (1 species)

7. Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)

8. Domain d1gavh_: 1gav H: [40103]

Details for d1gavh_

PDB Entry: 1gav, 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gavh_:

Sequence; same for both SEQRES and ATOM records:

>d1gavh_ d.85.1.1 (H:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

Timeline for d1gavh_:

• d1gavh_ first appeared (with stable ids) in SCOP 1.55
  
• d1gavh_ appears in SCOP 1.67
  
• d1gavh_ appears in SCOP 1.71
  
• d1gavh_ appears in the current release, SCOPe 2.08