Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) |
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
Protein GA coat protein [55409] (1 species) |
Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries) |
Domain d1gavg_: 1gav G: [40102] |
PDB Entry: 1gav (more details), 3.4 Å
SCOP Domain Sequences for d1gavg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gavg_ d.85.1.1 (G:) GA coat protein {Bacteriophage GA} atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea issqsgfya
Timeline for d1gavg_:
View in 3D Domains from other chains: (mouse over for more information) d1gav0_, d1gav1_, d1gav2_, d1gav3_, d1gav4_, d1gav5_, d1gav6_, d1gav7_, d1gav8_, d1gav9_, d1gava_, d1gavb_, d1gavc_, d1gavd_, d1gave_, d1gavf_, d1gavh_, d1gavi_, d1gavj_, d1gavk_, d1gavl_, d1gavm_, d1gavn_, d1gavo_, d1gavp_, d1gavq_, d1gavr_, d1gavs_, d1gavt_, d1gavu_, d1gavv_, d1gavw_, d1gavx_, d1gavy_, d1gavz_ |