Lineage for d1gav3_ (1gav 3:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507379Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 507380Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 507381Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 507390Protein GA coat protein [55409] (1 species)
  7. 507391Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 507397Domain d1gav3_: 1gav 3: [40124]

Details for d1gav3_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gav3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gav3_ d.85.1.1 (3:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gav3_:

Click to download the PDB-style file with coordinates for d1gav3_.
(The format of our PDB-style files is described here.)

Timeline for d1gav3_: