Lineage for d1mvbc_ (1mvb C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) Protein MS2 virus coat protein [55407] (1 species) Species Bacteriophage MS2 [TaxId:12022] [55408] (21 PDB entries) 
Domain d1mvbc_: 1mvb C: [40072]
Details for d1mvbc_
PDB Entry: 1mvb (more details), 3 Å
PDB Description: structure of a protein capsid of the t59s mutant of phage ms2
SCOP Domain Sequences for d1mvbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvbc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
SCOP Domain Coordinates for d1mvbc_:
Click to download the PDB-style file with coordinates for d1mvbc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mvbc_:
- d1mvbc_ appears in SCOP 1.57
- d1mvbc_ appears in the current release, SCOPe 2.08
View in 3D
