Lineage for d6m30d1 (6m30 D:2-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690581Species Staphylococcus equorum [TaxId:246432] [349734] (3 PDB entries)
  8. 2690586Domain d6m30d1: 6m30 D:2-90 [400052]
    Other proteins in same PDB: d6m30a2, d6m30b2, d6m30c2, d6m30d2, d6m30e2, d6m30f2
    automated match to d1xrea1
    complexed with mn; mutant

Details for d6m30d1

PDB Entry: 6m30 (more details), 1.74 Å

PDB Description: crystal structure of a mutant staphylococcus equorum manganese superoxide dismutase n73f
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d6m30d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m30d1 a.2.11.0 (D:2-90) automated matches {Staphylococcus equorum [TaxId: 246432]}
afelpnlpygfralephidqqtmeihhdkhhntyvtklnaavegtdlesksieeivanld
svpeniqtavrfnggghlnhslfwelltp

SCOPe Domain Coordinates for d6m30d1:

Click to download the PDB-style file with coordinates for d6m30d1.
(The format of our PDB-style files is described here.)

Timeline for d6m30d1: