SCOPe 2.08: Domain d6m30f1: 6m30 F:2-90

Lineage for d6m30f1 (6m30 F:2-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Staphylococcus equorum [TaxId:246432] [349734] (3 PDB entries)

8. Domain d6m30f1: 6m30 F:2-90 [400019]
   Other proteins in same PDB: d6m30a2, d6m30b2, d6m30c2, d6m30d2, d6m30e2, d6m30f2
   automated match to d1xrea1
   complexed with mn; mutant

Details for d6m30f1

PDB Entry: 6m30, 1.74 Å

PDB Description: crystal structure of a mutant staphylococcus equorum manganese superoxide dismutase n73f

PDB Compounds: (F:) superoxide dismutase

SCOPe Domain Sequences for d6m30f1:

Sequence; same for both SEQRES and ATOM records:

>d6m30f1 a.2.11.0 (F:2-90) automated matches {Staphylococcus equorum [TaxId: 246432]}
afelpnlpygfralephidqqtmeihhdkhhntyvtklnaavegtdlesksieeivanld
svpeniqtavrfnggghlnhslfwelltp

Timeline for d6m30f1:

• d6m30f1 first appeared in SCOPe 2.07