Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Staphylococcus equorum [TaxId:246432] [349734] (3 PDB entries) |
Domain d6m30f1: 6m30 F:2-90 [400019] Other proteins in same PDB: d6m30a2, d6m30b2, d6m30c2, d6m30d2, d6m30e2, d6m30f2 automated match to d1xrea1 complexed with mn; mutant |
PDB Entry: 6m30 (more details), 1.74 Å
SCOPe Domain Sequences for d6m30f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m30f1 a.2.11.0 (F:2-90) automated matches {Staphylococcus equorum [TaxId: 246432]} afelpnlpygfralephidqqtmeihhdkhhntyvtklnaavegtdlesksieeivanld svpeniqtavrfnggghlnhslfwelltp
Timeline for d6m30f1: