SCOPe 2.08: Domain d6m30c2: 6m30 C:91-199

Lineage for d6m30c2 (6m30 C:91-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Staphylococcus equorum [TaxId:246432] [349736] (3 PDB entries)

8. Domain d6m30c2: 6m30 C:91-199 [400035]
   Other proteins in same PDB: d6m30a1, d6m30b1, d6m30c1, d6m30d1, d6m30e1, d6m30f1
   automated match to d1xrea2
   complexed with mn; mutant

Details for d6m30c2

PDB Entry: 6m30, 1.74 Å

PDB Description: crystal structure of a mutant staphylococcus equorum manganese superoxide dismutase n73f

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d6m30c2:

Sequence; same for both SEQRES and ATOM records:

>d6m30c2 d.44.1.0 (C:91-199) automated matches {Staphylococcus equorum [TaxId: 246432]}
nseekgtvvdkikeqwgsldafkeefanqaaarfgsgwawlvvndgkleivttpnqdnpl
tegktpilgldvwehayylkyqnkrpdyisafwnvvnwekvdelynaak

Timeline for d6m30c2:

• d6m30c2 first appeared in SCOPe 2.07