SCOPe 2.07: Domain d7l62a1: 7l62 A:628-761

Lineage for d7l62a1 (7l62 A:628-761)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)

8. Domain d7l62a1: 7l62 A:628-761 [399435]
   Other proteins in same PDB: d7l62a2
   automated match to d3alta_
   complexed with bgc, ca, fuc, gal

Details for d7l62a1

PDB Entry: 7l62, 1.55 Å

PDB Description: c-type carbohydrate-recognition domain 4 of the mannose receptor complexed with l-fucose-(alpha 1-2)-d-galactose-(beta1-4)-d-glucose

PDB Compounds: (A:) Macrophage mannose receptor 1

SCOPe Domain Sequences for d7l62a1:

Sequence; same for both SEQRES and ATOM records:

>d7l62a1 d.169.1.0 (A:628-761) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita
sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn
dincehlnnwicqi

Timeline for d7l62a1:

• d7l62a1 is new in SCOPe 2.07-stable
  
• d7l62a1 appears in the current release, SCOPe 2.08