Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d7l62a1: 7l62 A:628-761 [399435] Other proteins in same PDB: d7l62a2 automated match to d3alta_ complexed with bgc, ca, fuc, gal |
PDB Entry: 7l62 (more details), 1.55 Å
SCOPe Domain Sequences for d7l62a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l62a1 d.169.1.0 (A:628-761) automated matches {Human (Homo sapiens) [TaxId: 9606]} cpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlita sgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswn dincehlnnwicqi
Timeline for d7l62a1: