| Class b: All beta proteins [48724] (178 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (16 species) not a true protein |
| Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries) |
| Domain d7kc7a3: 7kc7 A:329-451 [399184] Other proteins in same PDB: d7kc7a1, d7kc7a2, d7kc7b1, d7kc7b2 automated match to d1ulza1 complexed with adp, po4 |
PDB Entry: 7kc7 (more details), 2.2 Å
SCOPe Domain Sequences for d7kc7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kc7a3 b.84.2.0 (A:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae
Timeline for d7kc7a3: