Lineage for d7kc7a3 (7kc7 A:329-451)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2427009Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2427010Protein automated matches [254496] (16 species)
    not a true protein
  7. 2427053Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries)
  8. 2427056Domain d7kc7a3: 7kc7 A:329-451 [399184]
    Other proteins in same PDB: d7kc7a1, d7kc7a2, d7kc7b1, d7kc7b2
    automated match to d1ulza1
    complexed with adp, po4

Details for d7kc7a3

PDB Entry: 7kc7 (more details), 2.2 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to adp without magnesium with disordered phosphate tail
PDB Compounds: (A:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kc7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kc7a3 b.84.2.0 (A:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae

SCOPe Domain Coordinates for d7kc7a3:

Click to download the PDB-style file with coordinates for d7kc7a3.
(The format of our PDB-style files is described here.)

Timeline for d7kc7a3: