SCOPe 2.07: Domain d7kc7b3: 7kc7 B:329-451

Lineage for d7kc7b3 (7kc7 B:329-451)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Hydrogenobacter thermophilus [TaxId:940] [399169] (3 PDB entries)

8. Domain d7kc7b3: 7kc7 B:329-451 [399271]
   Other proteins in same PDB: d7kc7a1, d7kc7a2, d7kc7b1, d7kc7b2
   automated match to d1ulza1
   complexed with adp, po4

Details for d7kc7b3

PDB Entry: 7kc7, 2.2 Å

PDB Description: biotin carboxylase domain of thermophilic 2-oxoglutarate carboxylase bound to adp without magnesium with disordered phosphate tail

PDB Compounds: (B:) 2-oxoglutarate carboxylase small subunit

SCOPe Domain Sequences for d7kc7b3:

Sequence; same for both SEQRES and ATOM records:

>d7kc7b3 b.84.2.0 (B:329-451) automated matches {Hydrogenobacter thermophilus [TaxId: 940]}
fngysiecrinaedpkkgfapsigtieryyvpggfgirvehasskgyeitpyydsliakl
ivwaplwevavdrmrsaletyeisgvkttipllinimkdkdfrdgkfttryleehphvfd
yae

Timeline for d7kc7b3:

• d7kc7b3 is new in SCOPe 2.07-stable
  
• d7kc7b3 appears in the current release, SCOPe 2.08