Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Unknown prokaryotic [TaxId:2725] [398887] (1 PDB entry) |
Domain d7ds7a_: 7ds7 A: [398888] automated match to d4eb0a_ complexed with cit, gol, imd |
PDB Entry: 7ds7 (more details), 2.15 Å
SCOPe Domain Sequences for d7ds7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ds7a_ c.69.1.0 (A:) automated matches {Unknown prokaryotic [TaxId: 2725]} snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy tadasslawlgrrlashgfvvlvintnsrfdgpdsrasqlsaalnylrtsspsavrarld anrlavaghamggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv sqhaipfyqnlpsttpkvyvelcnashiapnsnnaaisvytiswmklwvdndtryrqflc nvndpalcdfrtnnrhcq
Timeline for d7ds7a_: