Lineage for d7ds7a_ (7ds7 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510748Species Unknown prokaryotic [TaxId:2725] [398887] (1 PDB entry)
  8. 2510749Domain d7ds7a_: 7ds7 A: [398888]
    automated match to d4eb0a_
    complexed with cit, gol, imd

Details for d7ds7a_

PDB Entry: 7ds7 (more details), 2.15 Å

PDB Description: the crystal structure of leaf-branch compost cutinase from biortus.
PDB Compounds: (A:) Leaf-branch compost cutinase

SCOPe Domain Sequences for d7ds7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ds7a_ c.69.1.0 (A:) automated matches {Unknown prokaryotic [TaxId: 2725]}
snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy
tadasslawlgrrlashgfvvlvintnsrfdgpdsrasqlsaalnylrtsspsavrarld
anrlavaghamggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv
sqhaipfyqnlpsttpkvyvelcnashiapnsnnaaisvytiswmklwvdndtryrqflc
nvndpalcdfrtnnrhcq

SCOPe Domain Coordinates for d7ds7a_:

Click to download the PDB-style file with coordinates for d7ds7a_.
(The format of our PDB-style files is described here.)

Timeline for d7ds7a_: