SCOPe 2.07: Domain d7d19b1: 7d19 B:2-205

Lineage for d7d19b1 (7d19 B:2-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries)

8. Domain d7d19b1: 7d19 B:2-205 [398767]
   Other proteins in same PDB: d7d19a2, d7d19b2
   automated match to d4mlpa1
   complexed with goc

Details for d7d19b1

PDB Entry: 7d19, 2.35 Å

PDB Description: crystal structure of mouse cryptochrome 1 in complex with compound th129

PDB Compounds: (B:) Cryptochrome-1

SCOPe Domain Sequences for d7d19b1:

Sequence; same for both SEQRES and ATOM records:

>d7d19b1 c.28.1.0 (B:2-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcled
ldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateag
vevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtp
lsddhdekygvpsleelgfdtdgl

Timeline for d7d19b1:

• d7d19b1 is new in SCOPe 2.07-stable
  
• d7d19b1 appears in the current release, SCOPe 2.08