Lineage for d7d19b1 (7d19 B:2-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861787Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861788Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2861825Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2861826Protein automated matches [227113] (4 species)
    not a true protein
  7. 2861841Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries)
  8. 2861860Domain d7d19b1: 7d19 B:2-205 [398767]
    Other proteins in same PDB: d7d19a2, d7d19b2
    automated match to d4mlpa1
    complexed with goc

Details for d7d19b1

PDB Entry: 7d19 (more details), 2.35 Å

PDB Description: crystal structure of mouse cryptochrome 1 in complex with compound th129
PDB Compounds: (B:) Cryptochrome-1

SCOPe Domain Sequences for d7d19b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d19b1 c.28.1.0 (B:2-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcled
ldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateag
vevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtp
lsddhdekygvpsleelgfdtdgl

SCOPe Domain Coordinates for d7d19b1:

Click to download the PDB-style file with coordinates for d7d19b1.
(The format of our PDB-style files is described here.)

Timeline for d7d19b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7d19b2