Lineage for d7d59h_ (7d59 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790509Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2790532Domain d7d59h_: 7d59 H: [398750]
    Other proteins in same PDB: d7d59f_, d7d59j_, d7d59k_, d7d59l_
    automated match to d2f3ia_
    complexed with sf4, zn

Details for d7d59h_

PDB Entry: 7d59 (more details), 3.1 Å

PDB Description: cryo-em structure of human rna polymerase iii in apo state
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d7d59h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d59h_ b.40.4.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvia
stlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsyggl
lmrlqgdannlhgfevdsrvyllmkklaf

SCOPe Domain Coordinates for d7d59h_:

Click to download the PDB-style file with coordinates for d7d59h_.
(The format of our PDB-style files is described here.)

Timeline for d7d59h_: