Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d7d59h_: 7d59 H: [398750] Other proteins in same PDB: d7d59f_, d7d59j_, d7d59k_, d7d59l_ automated match to d2f3ia_ complexed with sf4, zn |
PDB Entry: 7d59 (more details), 3.1 Å
SCOPe Domain Sequences for d7d59h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d59h_ b.40.4.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvia stlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsyggl lmrlqgdannlhgfevdsrvyllmkklaf
Timeline for d7d59h_:
View in 3D Domains from other chains: (mouse over for more information) d7d59f_, d7d59j_, d7d59k_, d7d59l_ |