Lineage for d7d59j_ (7d59 J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695676Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2695677Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2695715Protein automated matches [190336] (6 species)
    not a true protein
  7. 2695724Species Human (Homo sapiens) [TaxId:9606] [398822] (1 PDB entry)
  8. 2695725Domain d7d59j_: 7d59 J: [398823]
    Other proteins in same PDB: d7d59f_, d7d59h_, d7d59k_, d7d59l_
    automated match to d4c2mj_
    complexed with sf4, zn

Details for d7d59j_

PDB Entry: 7d59 (more details), 3.1 Å

PDB Description: cryo-em structure of human rna polymerase iii in apo state
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit RPABC5

SCOPe Domain Sequences for d7d59j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d59j_ a.4.11.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miipvrcftcgkivgnkweaylgllqaeytegdaldalglkryccrrmllahvdliekll
nyaplek

SCOPe Domain Coordinates for d7d59j_:

Click to download the PDB-style file with coordinates for d7d59j_.
(The format of our PDB-style files is described here.)

Timeline for d7d59j_: