Lineage for d7csvb_ (7csv B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709867Species Pseudomonas aeruginosa [TaxId:208964] [398682] (3 PDB entries)
  8. 2709869Domain d7csvb_: 7csv B: [398743]
    automated match to d4mcxa_

Details for d7csvb_

PDB Entry: 7csv (more details), 1.71 Å

PDB Description: pseudomonas aeruginosa antitoxin higa
PDB Compounds: (B:) HTH cro/C1-type domain-containing protein

SCOPe Domain Sequences for d7csvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7csvb_ a.35.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ngmrpihpgeilrdeflmefdispaalaralkvsaptvndivreqrgisadmairlgryf
dtsaqfwmnlqseyslatayaangkqieheiepllah

SCOPe Domain Coordinates for d7csvb_:

Click to download the PDB-style file with coordinates for d7csvb_.
(The format of our PDB-style files is described here.)

Timeline for d7csvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7csva_