Lineage for d4mcxa_ (4mcx A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. Protein Antitoxin HigA [158465] (2 species)
    Uncharacterized transcriptional regulator YddM
  7. Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries)
  8. Domain d4mcxa_: 4mcx A: [229678]
    automated match to d2icta_

Details for d4mcxa_

PDB Entry: 4mcx (more details), 2.1 Å

PDB Description: P. vulgaris HIGBA structure, crystal form 2
PDB Compounds: (A:) Antidote protein

SCOPe Domain Sequences for d4mcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcxa_ a.35.1.3 (A:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
mrqfkvshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaal
gstpefwlrlqsnydlrqlenqidtsgivlyge

SCOPe Domain Coordinates for d4mcxa_ are not available.

Timeline for d4mcxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mcxc_, d4mcxe_