SCOPe 2.08: Domain d7beod1: 7beo D:1-107

Lineage for d7beod1 (7beo D:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d7beod1: 7beo D:1-107 [398583]
   Other proteins in same PDB: d7beob1, d7beob2, d7beoc_, d7beod2, d7beof1, d7beof2, d7beoh_, d7beol2, d7beor_, d7beox_
   automated match to d1dn0a1
   complexed with act, cl, fuc, gol, nag

Details for d7beod1

PDB Entry: 7beo, 3.19 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-253h55l and covox-75 fabs

PDB Compounds: (D:) COVOX-253H55L light chain

SCOPe Domain Sequences for d7beod1:

Sequence; same for both SEQRES and ATOM records:

>d7beod1 b.1.1.1 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfgvyycqqygsspwtfgqgtkvei

Timeline for d7beod1:

• d7beod1 first appeared in SCOPe 2.07