SCOPe 2.08: Domain d7beob1: 7beo B:1-106

Lineage for d7beob1 (7beo B:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7beob1: 7beo B:1-106 [398419]
   Other proteins in same PDB: d7beoa_, d7beob2, d7beod1, d7beod2, d7beoe_, d7beof2, d7beol1, d7beol2, d7beor_, d7beox_
   automated match to d1dn0a1
   complexed with act, cl, fuc, gol, nag

Details for d7beob1

PDB Entry: 7beo, 3.19 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-253h55l and covox-75 fabs

PDB Compounds: (B:) COVOX-75 light chain

SCOPe Domain Sequences for d7beob1:

Sequence; same for both SEQRES and ATOM records:

>d7beob1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspssvsasvgdrvtitcrasqgisswlawyqqkpgkapklliyavsslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqaksfpftfgpgtkvei

Timeline for d7beob1:

• d7beob1 first appeared in SCOPe 2.07