Lineage for d1clib1 (1cli B:1021-1170)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209532Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1209969Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 1209970Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins)
  6. 1209971Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species)
  7. 1209972Species Escherichia coli [TaxId:562] [55329] (1 PDB entry)
  8. 1209974Domain d1clib1: 1cli B:1021-1170 [39817]
    Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2
    complexed with so4

Details for d1clib1

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution
PDB Compounds: (B:) protein (phosphoribosyl-aminoimidazole synthetase)

SCOPe Domain Sequences for d1clib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clib1 d.79.4.1 (B:1021-1170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli [TaxId: 562]}
alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh
dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg
etaempgmyhgedydvagfcvgvvekseii

SCOPe Domain Coordinates for d1clib1:

Click to download the PDB-style file with coordinates for d1clib1.
(The format of our PDB-style files is described here.)

Timeline for d1clib1: