![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins) |
![]() | Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55329] (1 PDB entry) |
![]() | Domain d1clib1: 1cli B:1021-1170 [39817] Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2 complexed with so4 |
PDB Entry: 1cli (more details), 2.5 Å
SCOPe Domain Sequences for d1clib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clib1 d.79.4.1 (B:1021-1170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli [TaxId: 562]} alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg etaempgmyhgedydvagfcvgvvekseii
Timeline for d1clib1: