Lineage for d1clib1 (1cli B:1021-1170)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33616Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 33706Superfamily d.79.4: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55326] (1 family) (S)
  5. 33707Family d.79.4.1: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55327] (1 protein)
  6. 33708Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species)
  7. 33709Species Escherichia coli [TaxId:562] [55329] (1 PDB entry)
  8. 33711Domain d1clib1: 1cli B:1021-1170 [39817]
    Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2

Details for d1clib1

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

SCOP Domain Sequences for d1clib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clib1 d.79.4.1 (B:1021-1170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli}
alvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgtdgvgtklrlamdlkrh
dtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavisgiaegclqsgcslvgg
etaempgmyhgedydvagfcvgvvekseii

SCOP Domain Coordinates for d1clib1:

Click to download the PDB-style file with coordinates for d1clib1.
(The format of our PDB-style files is described here.)

Timeline for d1clib1: