Lineage for d1e7kb_ (1e7k B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) 
Superfamily d.79.3: L30e-like [55315] (2 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) Protein Spliceosomal 15.5kd protein [55321] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55322] (1 PDB entry) 
Domain d1e7kb_: 1e7k B: [39814]
Details for d1e7kb_
PDB Entry: 1e7k (more details), 2.9 Å
PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
SCOP Domain Sequences for d1e7kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7kb_ d.79.3.1 (B:) Spliceosomal 15.5kd protein {Human (Homo sapiens)}
vnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaeplei
ilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsier
llv
SCOP Domain Coordinates for d1e7kb_:
Click to download the PDB-style file with coordinates for d1e7kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e7kb_:
- d1e7kb_ appears in SCOP 1.57
- d1e7kb_ appears in the current release, SCOPe 2.08
View in 3D
