| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Escherichia coli [TaxId:562] [55260] (1 PDB entry) |
| Domain d1bdfd1: 1bdf D:1-52,D:179-235 [39730] Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2 mutant |
PDB Entry: 1bdf (more details), 2.5 Å
SCOP Domain Sequences for d1bdfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdfd1 d.74.3.1 (D:1-52,D:179-235) RNA polymerase alpha {Escherichia coli}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
Timeline for d1bdfd1: