SCOP 1.65: Domain d1bdfd1: 1bdf D:1-52,D:179-235

Lineage for d1bdfd1 (1bdf D:1-52,D:179-235)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.74: DCoH-like [55247] (5 superfamilies)
beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
form homo and heterodimers
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
Protein RNA polymerase alpha [55259] (3 species)
Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
Domain d1bdfd1: 1bdf D:1-52,D:179-235 [39730]
Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2
mutant

Details for d1bdfd1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfd1 d.74.3.1 (D:1-52,D:179-235) RNA polymerase alpha {Escherichia coli}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

SCOP Domain Coordinates for d1bdfd1:

Click to download the PDB-style file with coordinates for d1bdfd1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfd1: