SCOPe 2.08: Domain d1bdfd1: 1bdf D:1-52,D:179-235

Lineage for d1bdfd1 (1bdf D:1-52,D:179-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)

8. Domain d1bdfd1: 1bdf D:1-52,D:179-235 [39730]
   Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfd1

PDB Entry: 1bdf, 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

PDB Compounds: (D:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1bdfd1:

Sequence; same for both SEQRES and ATOM records:

>d1bdfd1 d.74.3.1 (D:1-52,D:179-235) RNA polymerase alpha {Escherichia coli [TaxId: 562]}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

Timeline for d1bdfd1:

• d1bdfd1 first appeared (with stable ids) in SCOP 1.55
  
• d1bdfd1 appears in SCOPe 2.07