![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.74: DCoH-like [55247] (4 superfamilies) |
![]() | Superfamily d.74.3: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55257] (1 family) ![]() |
![]() | Family d.74.3.1: Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55258] (1 protein) |
![]() | Protein Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain [55259] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55260] (1 PDB entry) |
![]() | Domain d1bdfd1: 1bdf D:1-52,D:179-235 [39730] Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2 |
PDB Entry: 1bdf (more details), 2.5 Å
SCOP Domain Sequences for d1bdfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdfd1 d.74.3.1 (D:1-52,D:179-235) Dimerization subdomain of RNA polymerase alpha subunit N-terminal domain {Escherichia coli} mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr
Timeline for d1bdfd1: