Lineage for d1xxbb_ (1xxb B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258710Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 258743Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
    forms trimers with three closely packed beta-sheets
  5. 258744Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 258745Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 258763Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)
  8. 258771Domain d1xxbb_: 1xxb B: [39707]

Details for d1xxbb_

PDB Entry: 1xxb (more details), 2.6 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex

SCOP Domain Sequences for d1xxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxbb_ d.74.2.1 (B:) C-terminal domain of arginine repressor {Escherichia coli}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

SCOP Domain Coordinates for d1xxbb_:

Click to download the PDB-style file with coordinates for d1xxbb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxbb_: