SCOP 1.65: Domain d1xxbb_: 1xxb B:

Lineage for d1xxbb_ (1xxb B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)

8. Domain d1xxbb_: 1xxb B: [39707]

Details for d1xxbb_

PDB Entry: 1xxb, 2.6 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex

SCOP Domain Sequences for d1xxbb_:

Sequence; same for both SEQRES and ATOM records:

>d1xxbb_ d.74.2.1 (B:) C-terminal domain of arginine repressor {Escherichia coli}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

Timeline for d1xxbb_:

• d1xxbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1xxbb_ appears in SCOP 1.63
  
• d1xxbb_ appears in SCOP 1.67
  
• d1xxbb_ appears in the current release, SCOPe 2.08