![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
![]() | Protein automated matches [190158] (30 species) not a true protein |
![]() | Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries) |
![]() | Domain d6zk8o2: 6zk8 O:256-410 [396752] Other proteins in same PDB: d6zk8a1, d6zk8o1 automated match to d2ohha2 complexed with 1pe, fe, fmn, peg, so4 |
PDB Entry: 6zk8 (more details), 1.83 Å
SCOPe Domain Sequences for d6zk8o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zk8o2 c.23.5.0 (O:256-410) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev ldeyelyyvptedelekcynmgkrlavkvkemkte
Timeline for d6zk8o2: