SCOPe 2.07: Domain d6zk8o2: 6zk8 O:256-410

Lineage for d6zk8o2 (6zk8 O:256-410)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)

8. Domain d6zk8o2: 6zk8 O:256-410 [396752]
   Other proteins in same PDB: d6zk8a1, d6zk8o1
   automated match to d2ohha2
   complexed with 1pe, fe, fmn, peg, so4

Details for d6zk8o2

PDB Entry: 6zk8, 1.83 Å

PDB Description: native crystal structure of anaerobic f420h2-oxidase from methanothermococcus thermolithotrophicus at 1.8a resolution

PDB Compounds: (O:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6zk8o2:

Sequence; same for both SEQRES and ATOM records:

>d6zk8o2 c.23.5.0 (O:256-410) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemkte

Timeline for d6zk8o2:

• d6zk8o2 is new in SCOPe 2.07-stable
  
• d6zk8o2 appears in the current release, SCOPe 2.08