PDB entry 6zk8

View 6zk8 on RCSB PDB site
Description: Native crystal structure of anaerobic F420H2-Oxidase from Methanothermococcus thermolithotrophicus at 1.8A resolution
Class: oxidoreductase
Keywords: oxidase, four electron reduction, Oxygen, anaerobic, OXIDOREDUCTASE
Deposited on 2020-06-30, released 2020-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6zk8a1, d6zk8a2
  • Chain 'O':
    Compound: Coenzyme F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6zk8o1, d6zk8o2
  • Heterogens: PEG, 1PE, FE, FMN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6zk8A (A:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6zk8O (O:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte