Lineage for d6zk8a1 (6zk8 A:1-255)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603824Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries)
  8. 2603833Domain d6zk8a1: 6zk8 A:1-255 [396789]
    Other proteins in same PDB: d6zk8a2, d6zk8o2
    automated match to d2ohha1
    complexed with 1pe, fe, fmn, peg, so4

Details for d6zk8a1

PDB Entry: 6zk8 (more details), 1.83 Å

PDB Description: native crystal structure of anaerobic f420h2-oxidase from methanothermococcus thermolithotrophicus at 1.8a resolution
PDB Compounds: (A:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6zk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zk8a1 d.157.1.0 (A:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

SCOPe Domain Coordinates for d6zk8a1:

Click to download the PDB-style file with coordinates for d6zk8a1.
(The format of our PDB-style files is described here.)

Timeline for d6zk8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6zk8a2