Lineage for d6wm2e3 (6wm2 E:402-506)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717636Species Human (Homo sapiens) [TaxId:9606] [396080] (2 PDB entries)
  8. 2717641Domain d6wm2e3: 6wm2 E:402-506 [396123]
    Other proteins in same PDB: d6wm2d1, d6wm2d2, d6wm2e1, d6wm2e2, d6wm2f1, d6wm2f2, d6wm2g_, d6wm2n_, d6wm2q_
    automated match to d3gqbb3
    complexed with adp, clr, nag, psf, pty, wjp, wjs, wss

Details for d6wm2e3

PDB Entry: 6wm2 (more details), 3.1 Å

PDB Description: human v-atpase in state 1 with sidk and adp
PDB Compounds: (E:) V-type proton ATPase subunit B, brain isoform

SCOPe Domain Sequences for d6wm2e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wm2e3 a.69.1.0 (E:402-506) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mksaigegmtrkdhadvsnqlyacyaigkdvqamkavvgeealtsddllyleflqkfern
fiaqgpyenrtvfetldigwqllrifpkemlkripqstlsefypr

SCOPe Domain Coordinates for d6wm2e3:

Click to download the PDB-style file with coordinates for d6wm2e3.
(The format of our PDB-style files is described here.)

Timeline for d6wm2e3: