Lineage for d6wm2e2 (6wm2 E:118-401)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872363Domain d6wm2e2: 6wm2 E:118-401 [396122]
    Other proteins in same PDB: d6wm2d1, d6wm2d3, d6wm2e1, d6wm2e3, d6wm2f1, d6wm2f3, d6wm2g_, d6wm2n_, d6wm2q_
    automated match to d3gqbb2
    complexed with adp, clr, nag, psf, pty, wjp, wjs, wss

Details for d6wm2e2

PDB Entry: 6wm2 (more details), 3.1 Å

PDB Description: human v-atpase in state 1 with sidk and adp
PDB Compounds: (E:) V-type proton ATPase subunit B, brain isoform

SCOPe Domain Sequences for d6wm2e2:

Sequence, based on SEQRES records: (download)

>d6wm2e2 c.37.1.0 (E:118-401) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilrtpvsedmlgrvfngsgkpidrgpvvlaedfldimgqpinpqcriypeemiqtgisai
dgmnsiargqkipifsaaglphneiaaqicrqaglvkkskdvvdyseenfaivfaamgvn
metarffksdfeengsmdnvclflnlandptieriitprlalttaeflayqcekhvlvil
tdmssyaealrevsaareevpgrrgfpgymytdlatiyeragrvegrngsitqipiltmp
nddithpipdltgyitegqiyvdrqlhnrqiyppinvlpslsrl

Sequence, based on observed residues (ATOM records): (download)

>d6wm2e2 c.37.1.0 (E:118-401) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilrtpvsedmlgrvfngsgkpidrgpvvlaedfldimgqpinpqcriypeemiqtgisai
dgmnsiargqkipifsaaglphneiaaqicrqaglvkksenfaivfaamgvnmetarffk
sdfeengsmdnvclflnlandptieriitprlalttaeflayqcekhvlviltdmssyae
alrevsaareevpgrrgfpgymytdlatiyeragrvegrngsitqipiltmpnddithpi
pdltgyitegqiyvdrqlhnrqiyppinvlpslsrl

SCOPe Domain Coordinates for d6wm2e2:

Click to download the PDB-style file with coordinates for d6wm2e2.
(The format of our PDB-style files is described here.)

Timeline for d6wm2e2: